Name :
EPCAM (Human) Recombinant Protein
Biological Activity :
Human EPCAM recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4072
Amino Acid Sequence :
MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK with polyhistidine tag at the C-terminus.
Molecular Weight :
Storage and Stability :
Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year. Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ni-NTA chromatography
Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of EPCAM (Human) Recombinant Protein.
Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
EPCAM
Gene Alias :
17-1A, 323/A3, CD326, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, HEA125, KS1/4, KSA, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1, hEGP-2
Gene Description :
epithelial cell adhesion molecule
Gene Summary :
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq
Other Designations :
adenocarcinoma-associated antigen|carcinoma-associated antigen GA733-2|human epithelial glycoprotein-2|membrane component, chromosome 4, surface marker (35kD glycoprotein)|tumor-associated calcium signal transducer 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NOD-like Receptor Recombinant Proteins
MMP-7 Recombinant Proteins
Popular categories:
CLEC4A3
Complement Factor I