Product Name :
Recombinant Human ARHGEF9

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:O43307Gene Accession:BC117406

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
O43307

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
2,3,4-Trimethoxybenzaldehyde manufacturer Liraglutide Purity PMID:35213857 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
IDO-IN-4

Synonym :

Chemical Name :

CAS NO.:
1629125-65-0

Molecular formula :
C26H35N3O3

Molecular Weight:
437.57 g/mol

Classification :
MedChemExpress Products > Life Sciences > IDO-IN-4

Description:
IDO-IN-4 is a monoclonal antibody that inhibits the activity of IDO. It is a research tool for cell biology researchers and pharmacologists. It is an inhibitor of the enzyme IDO (indoleamine 2,3 dioxygenase) which is responsible for breaking down the amino acid tryptophan. In doing so, IDO-IN-4 blocks the production of serotonin, which can lead to depression or other mood disorders. The antibody also blocks the binding of ligands to their receptors, thus inhibiting cellular responses to extracellular signals. This product has high purity and CAS No. 1629125-65-0.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
319

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
839712-12-8 Synonym 52-39-1 supplier PMID:30000712 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human STXBP2

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:Q15833Gene Accession:BC002869

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
Q15833

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
KLC2 Antibody Autophagy MYPT1 Antibody medchemexpress PMID:34895098 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
H-Met-Met-OH

Synonym :

Chemical Name :

CAS NO.:
7349-78-2

Molecular formula :
C10H20N2O3S2

Molecular Weight:
280.41 g/mol

Classification :
MedChemExpress Products > Life Sciences > Peptides and Biochemicals > Research Peptides > H-Met-Met-OH

Description:
H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.

Purity :
>98%

Specifications :
25 mg

Price.:
85

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
555-66-8 References 53-86-1 IUPAC Name PMID:30521228 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human Interferon Lambda-1,IL-29,IFN-λ1 (C-10His)

Brief Description :

Accession No. :
Q8IU54

Calculated MW :
21.4kDa

Target Sequence :
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
Q8IU54

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Islet-1 Antibody In stock Iloprost Prostaglandin Receptor PMID:34970683 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Endo-BCN-PEG2-NHS ester

Synonym :

Chemical Name :

CAS NO.:
2243565-12-8

Molecular formula :
C22H30N2O8

Molecular Weight:
450.5 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Endo-BCN-PEG2-NHS ester

Description:
Endo-BCN-PEG2-NHS ester is a PEG linker that is commonly used in the field of pegylation. It belongs to the group of NHS PEG products and contains a bicyclo PEG structure. This heterobifunctional PEG contains an amido group, which allows for easy conjugation with other molecules. The BCN moiety in Endo-BCN-PEG2-NHS ester provides a reactive site for bioconjugation reactions. The N-hydroxysuccinimide (NHS) ester functional group enables efficient coupling to primary amines on target molecules, making it an ideal choice for pegylation applications. With its unique structure and versatile reactivity, Endo-BCN-PEG2-NHS ester offers a valuable tool for researchers in the development of innovative drug delivery systems and targeted therapies.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
138605-00-2 manufacturer 18883-66-4 manufacturer PMID:30252321 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human IGF2BP3

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:O00425Gene Accession:BC065269

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
O00425

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Topoisomerase IIα Antibody Technical Information Argireline manufacturer PMID:34728239 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
1,4-Dichlorobenzene-d4 solution

Synonym :

Chemical Name :

CAS NO.:
3855-82-1

Molecular formula :
C6D4Cl2

Molecular Weight:
151.03 g/mol

Classification :
MedChemExpress Products > Research Chemicals > 1,4-Dichlorobenzene-d4 solution

Description:
1,4-Dichlorobenzene-d4 solution is a chemical that can be used in wastewater treatment. It has been shown that it is effective in the removal of fatty acids and other organic substances from wastewater. This compound is also good at transporting particles and has an aromatic hydrocarbon group with an electron density of 2.1. 1,4-Dichlorobenzene-d4 solution can be used to manufacture industrial chemicals such as dry cleaning fluid and paint stripper. The synthesis of 1,4-Dichlorobenzene-d4 starts with the reaction of hydrochloric acid and benzene to produce hydrogen chloride gas and 1,4-dichlorobenzene.

Purity :
>98%

Specifications :
100 mg

Price.:
50

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
887375-67-9 Description 520-18-3 IUPAC Name PMID:31424801 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Human CFLAR

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:O15519Gene Accession:BC001602

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
O15519

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CTPS1 Antibody Technical Information Benzethonium Bacterial PMID:34774545 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Etamicastat hydrochloride

Synonym :

Chemical Name :

CAS NO.:
677773-32-9

Molecular formula :
C14H16ClF2N3OS

Molecular Weight:
347.8 g/mol

Classification :
MedChemExpress Products > Life Sciences > Etamicastat hydrochloride

Description:
Etamicastat hydrochloride is a drug that inhibits the activity of the human liver enzyme CYP2D6. It is an inhibitor of the acetylation of dopamine to noradrenaline, which is important for the synthesis of adrenaline and dopamine. Etamicastat hydrochloride has been shown to have affinity for both human and monkey tissues. It also inhibits hydroxylation in rat plasma, liver cytosol, and liver microsomes. This drug has also been shown to inhibit dopamine hydroxylase in rat brain tissue as well as in vitro studies with human liver preparations. Etamicastat hydrochloride has been found to be effective against Parkinson’s disease and other diseases that are associated with a decrease in dopamine levels.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
429

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
102121-60-8 Synonym 1264-72-8 MedChemExpress PMID:30725973 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com